HORDB

General Information

ID: hor006716
Uniprot ID: P07108
Protein name: Acyl-CoA-binding protein
Gene name: DBI
Organism: Homo sapiens (Human)
Family: ACBP family
Source: Human
Expression: Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.
Disease: Diseases associated with DBI include Schizophrenia 14 and Peroxisomal Biogenesis Disorder.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding; GO:0030156 benzodiazepine receptor binding; GO:0036042 long-chain fatty acyl-CoA binding; GO:0042802 identical protein binding
GO BP: GO:0006631 fatty acid metabolic process; GO:0036151 phosphatidylcholine acyl-chain remodeling; GO:1903060 negative regulation of protein lipidation; GO:1905920 positive regulation of CoA-transferase activity; GO:2001140 positive regulation of phospholipid transport
GO CC: GO:0005783 endoplasmic reticulum; GO:0005788 endoplasmic reticulum lumen; GO:0005794 Golgi apparatus; GO:0032994 protein-lipid complex; GO:0070062 extracellular exosome

Sequence Information

Sequence: SQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Length: 86
Propeptide: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Signal peptide: NA
Modification: T1 N-acetylserine;T7 N6-acetyllysine;T7 N6-succinyllysine;T16 N6-succinyllysine;T18 N6-acetyllysine;T28 Phosphotyrosine;T54 N6-(2-hydroxyisobutyryl)lysine;T54 N6-acetyllysine;T54 N6-malonyllysine;T54 N6-succinyllysine;T76 N6-acetyllysine;T76 N6-succinylly
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Mechanism: [Isoform 6]: Predominantly expressed in adipose tissue and hippocampus.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P07108-F1(AlphaFold_DB_ID)/2CB8(PDB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

2cb8.pdb

hor006716_AF2.pdb

hor006716_ESM.pdb

Physical Information

Mass:	1142955	Formula:	C443H690N116O136S3
Absent amino acids:	C	Common amino acids:	K
pI:	6.54	Basic residues:	17
Polar residues:	21	Hydrophobic residues:	25
Hydrophobicity:	-93.02	Boman Index:	-18726
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	60.23
Instability Index:	3215.7	Extinction Coefficient cystines:	16960
Absorbance 280nm:	199.53

Literature

PubMed ID: 3020548
Title: Cloning and expression of cDNA for human diazepam binding inhibitor, a natural ligand of an allosteric regulatory site of the gamma-aminobutyric acid type A receptor.
PubMed ID: 2881742
Title: Bovine and human cDNA sequences encoding a putative benzodiazepine receptor ligand.
PubMed ID: 16055366
Title: Identification of new acyl-CoA binding protein transcripts in human and mouse.
PubMed ID: 21698759
Title: Identification of a novel human Acyl-CoA binding protein isoform with a unique C-terminal domain.
PubMed ID: 20345851
Title: Specific regulation of low-abundance transcript variants encoding human Acyl-CoA binding protein (ACBP) isoforms.
PubMed ID: 15815621
Title: Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 3525533
Title: Complete amino acid sequences of bovine and human endozepines. Homology with rat diazepam binding inhibitor.
PubMed ID: 12665801
Title: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
PubMed ID: 1292782
Title: Purification and analysis of growth regulating proteins secreted by a human melanoma cell line.
PubMed ID: 7534063
Title: The characterization of two diazepam binding inhibitor (DBI) transcripts in humans.
PubMed ID: 17953517
Title: Acyl-CoA-binding protein (ACBP) localizes to the endoplasmic reticulum and Golgi in a ligand-dependent manner in mammalian cells.
PubMed ID: 19413330
Title: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
PubMed ID: 19608861
Title: Lysine acetylation targets protein complexes and co-regulates major cellular functions.
PubMed ID: 20068231
Title: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
PubMed ID: 21269460
Title: Initial characterization of the human central proteome.
PubMed ID: 21908771
Title: The first identification of lysine malonylation substrates and its regulatory enzyme.
PubMed ID: 22814378
Title: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
PubMed ID: 24275569
Title: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
PubMed ID: 25944712
Title: N-terminome analysis of the human mitochondrial proteome.
PubMed ID: 29192674
Title: Landscape of the regulatory elements for lysine 2-hydroxyisobutyrylation pathway.
PubMed ID: 17044054
Title: High resolution crystal structures of unliganded and liganded human liver ACBP reveal a new mode of binding for the acyl-CoA ligand.